PDB entry 4wvz

View 4wvz on RCSB PDB site
Description: Crystal structure of artificial crosslinked thiol dioxygenase G95C variant from Pseudomonas aeruginosa
Class: oxidoreductase
Keywords: Pseudomonas aeruginosa, thiol dioxygenase, cysteine dioxygenase, 3-MPA dioxygenase, 3-mercaptopropionic acid, non-heme mono-iron, Cupin, beta barrel, crosslink, OXIDOREDUCTASE
Deposited on 2014-11-09, released 2016-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol dioxygenase
    Species: Pseudomonas aeruginosa BWHPSA021 [TaxId:1402521]
    Gene: Q034_01739
    Database cross-references and differences (RAF-indexed):
    • Uniprot U8R530
      • engineered mutation (94)
    Domains in SCOPe 2.07: d4wvza_
  • Chain 'B':
    Compound: Thiol dioxygenase
    Species: Pseudomonas aeruginosa BWHPSA021 [TaxId:1402521]
    Gene: Q034_01739
    Database cross-references and differences (RAF-indexed):
    • Uniprot U8R530
      • engineered mutation (94)
    Domains in SCOPe 2.07: d4wvzb_
  • Chain 'C':
    Compound: Thiol dioxygenase
    Species: Pseudomonas aeruginosa BWHPSA021 [TaxId:1402521]
    Gene: Q034_01739
    Database cross-references and differences (RAF-indexed):
    • Uniprot U8R530 (Start-200)
      • engineered mutation (94)
      • expression tag (201-203)
    Domains in SCOPe 2.07: d4wvzc1, d4wvzc2
  • Chain 'D':
    Compound: Thiol dioxygenase
    Species: Pseudomonas aeruginosa BWHPSA021 [TaxId:1402521]
    Gene: Q034_01739
    Database cross-references and differences (RAF-indexed):
    • Uniprot U8R530 (Start-200)
      • engineered mutation (94)
      • expression tag (201-204)
    Domains in SCOPe 2.07: d4wvzd1, d4wvzd2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wvzA (A:)
    mssilrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqry
    qqyllhvdsrqrfsvvsfvwgpgqitpvhdhrvwcligmlrgaeysqpyafdaggrphps
    garrrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpf
    isgysnsrlpniwdlskenpasawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wvzA (A:)
    ilrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqqy
    llhvdsrqrfsvvsfvwgpgqitpvhdhrvwcligmlrgaeysqpyafdaggrphpsgar
    rrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfisg
    ysnsrlpniwdlske
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wvzB (B:)
    mssilrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqry
    qqyllhvdsrqrfsvvsfvwgpgqitpvhdhrvwcligmlrgaeysqpyafdaggrphps
    garrrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpf
    isgysnsrlpniwdlskenpasawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wvzB (B:)
    ilrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqqy
    llhvdsrqrfsvvsfvwgpgqitpvhdhrvwcligmlrgaeysqpyafdaggrphpsgar
    rrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfisg
    ysnsrlpniwdlske
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wvzC (C:)
    mssilrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqry
    qqyllhvdsrqrfsvvsfvwgpgqitpvhdhrvwcligmlrgaeysqpyafdaggrphps
    garrrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpf
    isgysnsrlpniwdlskenpasawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wvzC (C:)
    ilrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqqy
    llhvdsrqrfsvvsfvwgpgqitpvhdhrvwcligmlrgaeysqpyafdaggrphpsgar
    rrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfisg
    ysnsrlpniwdlskenpasaw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wvzD (D:)
    mssilrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqry
    qqyllhvdsrqrfsvvsfvwgpgqitpvhdhrvwcligmlrgaeysqpyafdaggrphps
    garrrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpf
    isgysnsrlpniwdlskenpasawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wvzD (D:)
    silrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqq
    yllhvdsrqrfsvvsfvwgpgqitpvhdhrvwcligmlrgaeysqpyafdaggrphpsga
    rrrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfis
    gysnsrlpniwdlskenpasaws