PDB entry 4wvv

View 4wvv on RCSB PDB site
Description: Chicken Galectin-8 N-terminal domain complexed with lactose
Class: sugar binding protein
Keywords: Lectin, carbohydrate recognition domain, sugar binding protein
Deposited on 2014-11-07, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: galectin
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q1W2P6 (0-144)
  Domains in SCOPe 2.07: d4wvva_
• Heterogens: LBT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4wvvA (A:)
  kkisnpiipyvgtilgglvpgelivlhgsipddadrfqvdlqcgssikpradvafhfnpr
  fkwsgcvvcntlerekwgweeityempfqkgrpfeivimilkdkfqvsvnkkhlllynhr
  isleridtlgiygkvqiksiefvsn