PDB entry 4wv1

View 4wv1 on RCSB PDB site
Description: Crystal structure of the FGFR2 D2 domain in complex with Fab 2B.1.3
Class: transferase/immune system
Keywords: FGFR2, Fab, Complex, Antibody, TRANSFERASE-IMMUNE SYSTEM complex
Deposited on 2014-11-04, released 2015-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WV1 (0-213)
    Domains in SCOPe 2.06: d4wv1a1, d4wv1a2
  • Chain 'B':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WV1 (0-229)
  • Chain 'C':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wv1c_
  • Chain 'D':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WV1 (0-213)
    Domains in SCOPe 2.06: d4wv1d1, d4wv1d2
  • Chain 'E':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WV1 (0-229)
  • Chain 'F':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wv1f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wv1A (A:)
    diqmtqspsslsasvgdrvtitcrasqdvdtslawykqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqstghpqtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wv1C (C:)
    apywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvrnq
    hwslimesvvpsdkgnytcvveneygsinhtyhldvver
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wv1C (C:)
    pywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvrnqh
    wslimesvvpsdkgnytcvveneygsinhtyhldvver
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wv1D (D:)
    diqmtqspsslsasvgdrvtitcrasqdvdtslawykqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqstghpqtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4wv1F (F:)
    apywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvrnq
    hwslimesvvpsdkgnytcvveneygsinhtyhldvver
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wv1F (F:)
    pywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvrnqh
    wslimesvvpsdkgnytcvveneygsinhtyhldvver