PDB entry 4wuv

View 4wuv on RCSB PDB site
Description: Crystal Structure of a putative D-Mannonate oxidoreductase from Haemophilus influenza (Avi_5165, TARGET EFI-513796) with bound NAD
Class: oxidoreductase
Keywords: oxidoreductase, ENZYME FUNCTION INITIATIVE, EFI, Structural Genomics
Deposited on 2014-11-03, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase
    Species: Haemophilus influenzae RdAW [TaxId:656912]
    Gene: HICG_00830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wuva_
  • Chain 'B':
    Compound: 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase
    Species: Haemophilus influenzae RdAW [TaxId:656912]
    Gene: HICG_00830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wuvb_
  • Heterogens: NAD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wuvA (A:)
    mhhhhhhssgvdlgtenlyfqsmeftmniaanhnlenkliiitgaggvlcsflakqlayt
    kanialldlnfeaadkvakeinqsggkakayktnvlelenikevrnqietdfgtcdilin
    gaggnnpkattdnefhqfdlnettrtffdldksgiefvfnlnylgsllptqvfakdmlgk
    qganiinissmnaftpltkipaysgakaaisnftqwlavyfskvgircnaiapgflvsnq
    nlallfdtegkptdrankiltntpmgrfgeseellgallflidenysafvngvvlpvdgg
    fsaysgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wuvA (A:)
    niaanhnlenkliiitgaggvlcsflakqlaytkanialldlnfeaadkvakeinqsggk
    akayktnvlelenikevrnqietdfgtcdilingaggnnpkattdnefhqfdlnettrtf
    fdldksgiefvfnlnylgsllptqvfakdmlgkqganiinissmnaftpltkipaysgak
    aaisnftqwlavyfskvgircnaiapgflvsnqnlallfdtegkptdrankiltntpmgr
    fgeseellgallflidenysafvngvvlpvdggfsaysgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wuvB (B:)
    mhhhhhhssgvdlgtenlyfqsmeftmniaanhnlenkliiitgaggvlcsflakqlayt
    kanialldlnfeaadkvakeinqsggkakayktnvlelenikevrnqietdfgtcdilin
    gaggnnpkattdnefhqfdlnettrtffdldksgiefvfnlnylgsllptqvfakdmlgk
    qganiinissmnaftpltkipaysgakaaisnftqwlavyfskvgircnaiapgflvsnq
    nlallfdtegkptdrankiltntpmgrfgeseellgallflidenysafvngvvlpvdgg
    fsaysgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wuvB (B:)
    niaanhnlenkliiitgaggvlcsflakqlaytkanialldlnfeaadkvakeinqsggk
    akayktnvlelenikevrnqietdfgtcdilingaggnnpkattdnefhqfdlnettrtf
    fdldksgiefvfnlnylgsllptqvfakdmlgkqganiinissmnaftpltkipaysgak
    aaisnftqwlavyfskvgircnaiapgflvsnqnlallfdtegkptdrankiltntpmgr
    fgeseellgallflidenysafvngvvlpvdggfsaysgv