PDB entry 4wuc

View 4wuc on RCSB PDB site
Description: N-terminal 43 kDa fragment of the E. coli DNA gyrase B subunit grown from 100 mM NaCl condition
Class: isomerase
Keywords: DNA gyrase, ATPase domain, ATPase activity, GHKL superfamily, monovalent cations, isomerase
Deposited on 2014-10-31, released 2015-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Escherichia coli strain K-12 [TaxId:83333]
    Gene: gyrB, acrB, himB, hisU, nalC, parA, pcbA, b3699, JW5625
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4wuca1, d4wuca2
  • Heterogens: ANP, MG, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wucA (A:)
    snsydsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiiv
    tihadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvs
    vvnalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvte
    feyeilakrlrelsflnsgvsirlrdkrdgkedhfhyeggikafveylnknktpihpnif
    yfstekdgigvevalqwndgfqeniycftnnipqrdggthlagfraamtrtlnaymdkeg
    yskkakvsatgddaregliavvsvkvpdpkfssqtkdklvssevksaveqqmnellaeyl
    lenptdakivvgkiidaarareaarraremtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wucA (A:)
    sydsssikvlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivti
    hadnsvsvqddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvv
    nalsqklelviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefe
    yeilakrlrelsflnsgvsirlrdkrdgkedhfhyeggikafveylnknktpihpnifyf
    stekdgigvevalqwndgfqeniycftnnipqrdggthlagfraamtrtlnaymdkegys
    satgddaregliavvsvkvpdpkfssqtkdklvssevksaveqqmnellaeyllenptda
    kivvgkiidaarareaarraremt