PDB entry 4wu0

View 4wu0 on RCSB PDB site
Description: Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105
Class: hydrolase
Keywords: Pectin, Rhamnogalacturonan, unsaturated rhamnogalacturonan hydrolase, glycoside hydrolase, YteR, hydrolase
Deposited on 2014-10-30, released 2015-07-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Similar to yteR (Bacilus subtilis)
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: CA_C0359
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4wu0a_
  • Chain 'B':
    Compound: Similar to yteR (Bacilus subtilis)
    Species: Clostridium acetobutylicum [TaxId:272562]
    Gene: CA_C0359
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4wu0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wu0A (A:)
    mqkysklmadsiiaknitltdhwgyeygltldgiakvyewtkdkkyldfiiktmdtfine
    dgtingykleeynidhlnngkilitlfketgkekyrkalinlrkqidnhprtkenvfwhk
    niyphqiwldglymgatfyakyvkefgeekefddithqfiiteknlkdnktgllyhayde
    sktepwsnsetglsphfwgramgwyvmaladtievlpknhkdrnalikilnncvtallkv
    qdnaskvwyqvldegerkgnyleasgssmivyallkgvrlgylpeslketakeaykglin
    efiletkdglinlnkicyvaglggkdkrdgsfayyisepivsnepkglgpfllasyeyet
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wu0A (A:)
    qkysklmadsiiaknitltdhwgyeygltldgiakvyewtkdkkyldfiiktmdtfined
    gtingykleeynidhlnngkilitlfketgkekyrkalinlrkqidnhprtkenvfwhkn
    iyphqiwldglymgatfyakyvkefgeekefddithqfiiteknlkdnktgllyhaydes
    ktepwsnsetglsphfwgramgwyvmaladtievlpknhkdrnalikilnncvtallkvq
    dnaskvwyqvldegerkgnyleasgssmivyallkgvrlgylpeslketakeaykgline
    filetkdglinlnkicyvaglggkdkrdgsfayyisepivsnepkglgpfllasyeyetl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wu0B (B:)
    mqkysklmadsiiaknitltdhwgyeygltldgiakvyewtkdkkyldfiiktmdtfine
    dgtingykleeynidhlnngkilitlfketgkekyrkalinlrkqidnhprtkenvfwhk
    niyphqiwldglymgatfyakyvkefgeekefddithqfiiteknlkdnktgllyhayde
    sktepwsnsetglsphfwgramgwyvmaladtievlpknhkdrnalikilnncvtallkv
    qdnaskvwyqvldegerkgnyleasgssmivyallkgvrlgylpeslketakeaykglin
    efiletkdglinlnkicyvaglggkdkrdgsfayyisepivsnepkglgpfllasyeyet
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wu0B (B:)
    qkysklmadsiiaknitltdhwgyeygltldgiakvyewtkdkkyldfiiktmdtfined
    gtingykleeynidhlnngkilitlfketgkekyrkalinlrkqidnhprtkenvfwhkn
    iyphqiwldglymgatfyakyvkefgeekefddithqfiiteknlkdnktgllyhaydes
    ktepwsnsetglsphfwgramgwyvmaladtievlpknhkdrnalikilnncvtallkvq
    dnaskvwyqvldegerkgnyleasgssmivyallkgvrlgylpeslketakeaykgline
    filetkdglinlnkicyvaglggkdkrdgsfayyisepivsnepkglgpfllasyeyetl