PDB entry 4wtb

View 4wtb on RCSB PDB site
Description: BthTX-I, a svPLA2s-like toxin, complexed with zinc ions
Class: toxin
Keywords: svPLA2-like inhibitor, BthTX-I, toxin
Deposited on 2014-10-29, released 2015-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic phospholipase A2 homolog bothropstoxin-1
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90249 (0-120)
      • conflict (116)
    Domains in SCOPe 2.08: d4wtba_
  • Chain 'B':
    Compound: Basic phospholipase A2 homolog bothropstoxin-1
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90249 (0-120)
      • conflict (116)
    Domains in SCOPe 2.08: d4wtbb_
  • Heterogens: ZN, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wtbA (A:)
    slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckladp
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wtbB (B:)
    slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckladp
    c