PDB entry 4wsw

View 4wsw on RCSB PDB site
Description: The crystal structure of hemagglutinin from A/green-winged teal/Texas/Y171/2006 influenza virus
Class: viral protein
Keywords: Hemagglutinin, influenza virus, H10, VIRAL PROTEIN
Deposited on 2014-10-28, released 2015-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSW
    Domains in SCOPe 2.07: d4wswa_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSW (0-End)
    Domains in SCOPe 2.07: d4wswb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSW
    Domains in SCOPe 2.07: d4wswc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSW (0-End)
    Domains in SCOPe 2.07: d4wswd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSW
    Domains in SCOPe 2.07: d4wswe_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSW (0-End)
    Domains in SCOPe 2.07: d4wswf_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wswA (A:)
    adpgdkiclghhavsngtivktltnekeevtnatetvesksldklcmksrnykdlgschp
    igmvigtpacdlhltgtwdtlierdnsiaycypgatvneealrqkimesggidkistgft
    ygssinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdsaehliiwgih
    hpsstqekndlygtqslsisvgsstyqnnfvpvvgarpqvngqsgridfhwtmvqpgdni
    tfshnggliapsrvsklkgrglgiqsgasvdndceskcfwkggsintklpfqnlsprtvg
    qcpkyvnkkslllatgmrnvpevvqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wswA (A:)
    gdkiclghhavsngtivktltnekeevtnatetvesksldklcmksrnykdlgschpigm
    vigtpacdlhltgtwdtlierdnsiaycypgatvneealrqkimesggidkistgftygs
    sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdsaehliiwgihhps
    stqekndlygtqslsisvgsstyqnnfvpvvgarpqvngqsgridfhwtmvqpgdnitfs
    hnggliapsrvsklkgrglgiqsgasvdndceskcfwkggsintklpfqnlsprtvgqcp
    kyvnkkslllatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wswB (B:)
    glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
    tefesiesefseiehqigniinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhkcddncmesirnntydhtqyreeallnrlninsgrlvp
    rg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wswB (B:)
    glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
    tefesiesefseiehqigniinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhkcddncmesirnntydhtqyreeallnrln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wswC (C:)
    adpgdkiclghhavsngtivktltnekeevtnatetvesksldklcmksrnykdlgschp
    igmvigtpacdlhltgtwdtlierdnsiaycypgatvneealrqkimesggidkistgft
    ygssinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdsaehliiwgih
    hpsstqekndlygtqslsisvgsstyqnnfvpvvgarpqvngqsgridfhwtmvqpgdni
    tfshnggliapsrvsklkgrglgiqsgasvdndceskcfwkggsintklpfqnlsprtvg
    qcpkyvnkkslllatgmrnvpevvqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wswC (C:)
    gdkiclghhavsngtivktltnekeevtnatetvesksldklcmksrnykdlgschpigm
    vigtpacdlhltgtwdtlierdnsiaycypgatvneealrqkimesggidkistgftygs
    sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdsaehliiwgihhps
    stqekndlygtqslsisvgsstyqnnfvpvvgarpqvngqsgridfhwtmvqpgdnitfs
    hnggliapsrvsklkgrglgiqsgasvdndceskcfwkggsintklpfqnlsprtvgqcp
    kyvnkkslllatgmrnvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wswD (D:)
    glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
    tefesiesefseiehqigniinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhkcddncmesirnntydhtqyreeallnrlninsgrlvp
    rg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wswD (D:)
    glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
    tefesiesefseiehqigniinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhkcddncmesirnntydhtqyreeallnrln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4wswE (E:)
    adpgdkiclghhavsngtivktltnekeevtnatetvesksldklcmksrnykdlgschp
    igmvigtpacdlhltgtwdtlierdnsiaycypgatvneealrqkimesggidkistgft
    ygssinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdsaehliiwgih
    hpsstqekndlygtqslsisvgsstyqnnfvpvvgarpqvngqsgridfhwtmvqpgdni
    tfshnggliapsrvsklkgrglgiqsgasvdndceskcfwkggsintklpfqnlsprtvg
    qcpkyvnkkslllatgmrnvpevvqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wswE (E:)
    gdkiclghhavsngtivktltnekeevtnatetvesksldklcmksrnykdlgschpigm
    vigtpacdlhltgtwdtlierdnsiaycypgatvneealrqkimesggidkistgftygs
    sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdsaehliiwgihhps
    stqekndlygtqslsisvgsstyqnnfvpvvgarpqvngqsgridfhwtmvqpgdnitfs
    hnggliapsrvsklkgrglgiqsgasvdndceskcfwkggsintklpfqnlsprtvgqcp
    kyvnkkslllatgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4wswF (F:)
    glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
    tefesiesefseiehqigniinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhkcddncmesirnntydhtqyreeallnrlninsgrlvp
    rg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wswF (F:)
    glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
    tefesiesefseiehqigniinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhkcddncmesirnntydhtqyreeallnrln