PDB entry 4wsv

View 4wsv on RCSB PDB site
Description: The crystal structure of hemagglutinin from A/Taiwan/1/2013 in complex with 6'SLN
Class: viral protein
Keywords: Hemagglutinin, influenza virus, H6, VIRAL PROTEIN
Deposited on 2014-10-28, released 2015-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus H6N1 subtype [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSV
    Domains in SCOPe 2.06: d4wsva1, d4wsva2
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus H6N1 subtype [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSV (0-End)
    Domains in SCOPe 2.06: d4wsvb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus H6N1 subtype [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSV
    Domains in SCOPe 2.06: d4wsvc1, d4wsvc2
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus H6N1 subtype [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSV (0-End)
    Domains in SCOPe 2.06: d4wsvd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus H6N1 subtype [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSV
    Domains in SCOPe 2.06: d4wsve1, d4wsve2
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus H6N1 subtype [TaxId:119212]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSV (0-End)
    Domains in SCOPe 2.06: d4wsvf_
  • Heterogens: NAG, SIA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wsvA (A:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsvA (A:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wsvB (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsvB (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wsvC (C:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsvC (C:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wsvD (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsvD (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4wsvE (E:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsvE (E:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4wsvF (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsvF (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl