PDB entry 4wsu

View 4wsu on RCSB PDB site
Description: The crystal structure of hemagglutinin from A/Taiwan/1/2013 in complex with 3'SLN
Class: viral protein
Keywords: Hemagglutinin, influenza virus, H6, VIRAL PROTEIN
Deposited on 2014-10-28, released 2015-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSU
    Domains in SCOPe 2.06: d4wsua1, d4wsua2
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSU (0-End)
    Domains in SCOPe 2.06: d4wsub_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSU
    Domains in SCOPe 2.06: d4wsuc1, d4wsuc2
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSU (0-End)
    Domains in SCOPe 2.06: d4wsud_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSU
    Domains in SCOPe 2.06: d4wsue1, d4wsue2
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSU (0-End)
    Domains in SCOPe 2.06: d4wsuf_
  • Heterogens: NAG, SIA, GAL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wsuA (A:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsuA (A:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wsuB (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsuB (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wsuC (C:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsuC (C:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wsuD (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsuD (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4wsuE (E:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsuE (E:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4wsuF (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsuF (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnr