PDB entry 4wst

View 4wst on RCSB PDB site
Description: The crystal structure of hemagglutinin from A/Taiwan/1/2013 influenza virus
Class: viral protein
Keywords: Hemagglutinin, influenza virus, H6, VIRAL PROTEIN
Deposited on 2014-10-28, released 2015-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST
    Domains in SCOPe 2.06: d4wsta1, d4wsta2
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST (0-End)
    Domains in SCOPe 2.06: d4wstb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST
    Domains in SCOPe 2.06: d4wstc1, d4wstc2
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST (0-End)
    Domains in SCOPe 2.06: d4wstd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST
    Domains in SCOPe 2.06: d4wste1, d4wste2
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST (0-End)
    Domains in SCOPe 2.06: d4wstf_
  • Chain 'G':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST
    Domains in SCOPe 2.06: d4wstg1, d4wstg2
  • Chain 'H':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST (0-End)
    Domains in SCOPe 2.06: d4wsth_
  • Chain 'I':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST
    Domains in SCOPe 2.06: d4wsti1, d4wsti2
  • Chain 'J':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST (0-End)
    Domains in SCOPe 2.06: d4wstj_
  • Chain 'K':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST
    Domains in SCOPe 2.06: d4wstk1, d4wstk2
  • Chain 'L':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WST (0-End)
    Domains in SCOPe 2.06: d4wstl_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wstA (A:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstA (A:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wstB (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstB (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wstC (C:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstC (C:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wstD (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstD (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4wstE (E:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstE (E:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4wstF (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstF (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4wstG (G:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstG (G:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4wstH (H:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstH (H:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4wstI (I:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstI (I:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4wstJ (J:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstJ (J:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4wstK (K:)
    adlgsdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdc
    tiegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfe
    mfpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpil
    yfwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvl
    rpgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfq
    nvsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstK (K:)
    sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
    tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
    lwigecpkyvkseslrlatglrnvp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4wstL (L:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiesgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wstL (L:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl