PDB entry 4wrl

View 4wrl on RCSB PDB site
Description: Structure of the human CSF-1:CSF-1R complex
Class: cytokine/cytokine receptor
Keywords: cytokine-cytokine receptor complex
Deposited on 2014-10-24, released 2015-08-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage colony-stimulating factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: CSF1R, FMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07333 (0-276)
      • engineered mutation (220)
  • Chain 'B':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4wrlb_
  • Chain 'C':
    Compound: Macrophage colony-stimulating factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: CSF1R, FMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07333 (0-276)
      • engineered mutation (220)
  • Chain 'D':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4wrld_
  • Heterogens: NAG, FUC, GAL, SIA

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wrlB (B:)
    mgsshhhhhhssglvprgshmeevseycshmigsghlqslqrlidsqmetscqitfefvd
    qeqlkdpvcylkkafllvqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehd
    kacvrtfyetplqllekvknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wrlB (B:)
    evseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
    edtmrfrdntpnaiaivqlqelslrlkscftkdykacvrtfyetplqllekvknvfnetk
    nlldkdwnifskncnnsfaec
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wrlD (D:)
    mgsshhhhhhssglvprgshmeevseycshmigsghlqslqrlidsqmetscqitfefvd
    qeqlkdpvcylkkafllvqdimedtmrfrdntpnaiaivqlqelslrlkscftkdyeehd
    kacvrtfyetplqllekvknvfnetknlldkdwnifskncnnsfaecssq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wrlD (D:)
    evseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
    edtmrfrdntpnaiaivqlqelslrlkscftkdykacvrtfyetplqllekvknvfnetk
    nlldkdwnifskncnnsfaec