PDB entry 4wrg

View 4wrg on RCSB PDB site
Description: 1.9 angstrom structure of EGFR kinase domain
Class: transferase
Keywords: transferase, kinase domain
Deposited on 2014-10-23, released 2014-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4wrga1, d4wrga2
  • Heterogens: NA, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wrgA (A:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wrgA (A:)
    amgeapnqallrilketefkkikvlgtvykglwipegekvkipvaikespknkeildeay
    vmasvdnphvcrllgicltsvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgm
    nyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaekvpikwmalesil
    hriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymim
    vkcwmidadsrpkfreliiefskmardpqrylviqgdmddvvdadeylip