PDB entry 4wre

View 4wre on RCSB PDB site
Description: Crystal Structure of Surfactant Protein-A DEDN Mutant (E171D/P175E/R197N/K203D) Complexed with Inositol
Class: sugar binding protein
Keywords: collectin, carbohydrate binding, lectin, lipid binding, sugar binding protein
Deposited on 2014-10-23, released 2016-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sftpa1, Sftp-1, Sftp1, Sftpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08427 (Start-147)
      • engineered mutation (90)
      • engineered mutation (106)
      • engineered mutation (116)
      • engineered mutation (122)
    Domains in SCOPe 2.08: d4wrea1, d4wrea2
  • Heterogens: CA, INS, HEZ, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4wreA (A:)
ayldeelqtelyeikhqilqtmgvlslqgsmlsvgdkvfstngqsvnfdtikemctragg
niavprtpeeneaiasiakkynnyvylgmiddqtegdfhyldgasvsytnwypgepngqg
kedcvemytdgtwndrgclqyrlavcef

    Sequence, based on observed residues (ATOM records): (download) 
    >4wreA (A:)
qtelyeikhqilqtmgvlslqgsmlsvgdkvfstngqsvnfdtikemctraggniavprt
peeneaiasiakkynnyvylgmiddfhyldgasvsytnwypgepngqgkedcvemytdgt
wndrgclqyrlavcef