PDB entry 4wrd

View 4wrd on RCSB PDB site
Description: Crystal structure of Staphylcoccal nulease variant Delta+PHS V66E L125E at cryogenic temperature
Class: hydrolase
Keywords: nuclease, pdTp, pH-sensitive switch, hydrolase, internal ionizable groups
Deposited on 2014-10-23, released 2015-07-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: nuc, SACOL0860
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HHM4
      • engineered mutation (43-44)
      • engineered mutation (59)
      • engineered mutation (110)
      • engineered mutation (118)
      • engineered mutation (121)
    Domains in SCOPe 2.05: d4wrda_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wrdA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkme
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqler
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wrdA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmeenakki
    evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqlerkaeaqa
    kkeklniws