PDB entry 4wqj

View 4wqj on RCSB PDB site
Description: Crystal Structure of CYP119 from Sulfolobus acidocaldarius, Collected at 298K and Complexed with 4-(4-bromophenyl)-1H imidazole
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2014-10-22, released 2015-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 119
    Species: Sulfolobus acidocaldarius [TaxId:330779]
    Gene: cyp119, Saci_2081
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wqja_
  • Heterogens: HEM, 36Y, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wqjA (A:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wqjA (A:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksn