PDB entry 4wq5

View 4wq5 on RCSB PDB site
Description: YgjD(V85E)-YeaZ heterodimer in complex with ATP
Class: transferase
Keywords: heterodimer, YgjD-YeaZ, Val85Glu, t6A, transferase
Deposited on 2014-10-21, released 2015-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA N6-adenosine threonylcarbamoyltransferase
    Species: Escherichia coli [TaxId:83333]
    Gene: tsaD, gcp, ygjD, b3064, JW3036
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05852 (0-End)
      • engineered mutation (84)
  • Chain 'B':
    Compound: tRNA N6-adenosine threonylcarbamoyltransferase
    Species: Escherichia coli [TaxId:83333]
    Gene: tsaD, gcp, ygjD, b3064, JW3036
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05852 (0-End)
      • engineered mutation (84)
  • Chain 'C':
    Compound: tRNA threonylcarbamoyladenosine biosynthesis protein tsab
    Species: Escherichia coli [TaxId:83333]
    Gene: tsaB, yeaZ, b1807, JW1796
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wq5c1, d4wq5c2
  • Chain 'D':
    Compound: tRNA threonylcarbamoyladenosine biosynthesis protein tsab
    Species: Escherichia coli [TaxId:83333]
    Gene: tsaB, yeaZ, b1807, JW1796
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wq5d1, d4wq5d2
  • Heterogens: MG, FE, ATP, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wq5C (C:)
    mrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinala
    ygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidarmg
    evywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesglv
    lrdgevllpaaedmlpiacqmfaegktvavehaepvylrnnvawkklpgkehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wq5C (C:)
    mrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinala
    ygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidarmg
    evywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesglv
    lrdgevllpaaedmlpiacqmfaegktvavehaepvylrnnvwkklp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wq5D (D:)
    mrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinala
    ygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidarmg
    evywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesglv
    lrdgevllpaaedmlpiacqmfaegktvavehaepvylrnnvawkklpgkehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wq5D (D:)
    mrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinala
    ygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidarmg
    evywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesglv
    lrdgevllpaaedmlpiacqmfaegktvavehaepvylrnnvawkklp