PDB entry 4wpv

View 4wpv on RCSB PDB site
Description: Crystal Structure of E83A mutant of Mtb PEPCK in complex with Zn2+ and phosphate ion
Class: lyase,transferase
Keywords: GTP-dependent PEPCK, metal binding protein, LYASE, TRANSFERASE
Deposited on 2014-10-21, released 2015-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: pckG, MRA_0219
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5TYT6 (Start-621)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d4wpva1, d4wpva2
  • Heterogens: GOL, ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wpvA (A:)
    hhhhhhssglvpagshmtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseee
    fqrlcdqlveagtfirlnpekhknsylalsdpsdvarvasrtyicsakeidagptnnwmd
    pgemrsimkdlyrgcmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgk
    aalekmgddgffvkalhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggna
    llgkkcyslriasamahdegwlaehmlilklispenkayyfaaafpsacgktnlamlqpt
    ipgwraetlgddiawmrfgkdgrlyavnpefgffgvapgtnwksnpnamrtiaagntvft
    nvaltddgdvwweglegdpqhlidwkgndwyfretetnaahpnsryctpmsqcpilapew
    ddpqgvpisgilfggrrkttvplvteardwqhgvfigatlgseqtaaaegkvgnvrrdpm
    amlpflgynvgdyfqhwinlgkhadesklpkvffvnwfrrgddgrflwpgfgensrvlkw
    ivdriehkaggattpigtvpavedldldgldvdaadvaaalavdadewrqelplieewlq
    fvgeklptgvkdefdalkerlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wpvA (A:)
    ptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpekhknsyla
    lsdpsdvarvasrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtmyvvpfcm
    gplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvgaplepgqk
    dvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdegwlaehmli
    lklispenkayyfaaafpsacgktnlamlqptipgwraetlgddiawmrfgkdgrlyavn
    pefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpqhlidwkgn
    dwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrkttvplvtear
    dwqhgvfigatlgseqtnvrrdpmamlpflgynvgdyfqhwinlgkhadesklpkvffvn
    wfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvpavedldldgldvdaad
    vaaalavdadewrqelplieewlqfvgeklptgvkdefdalkerlg