PDB entry 4wpu

View 4wpu on RCSB PDB site
Description: Crystal Structure of E83A mutant of Mtb PEPCK in complex with PEP and GDP
Class: lyase,transferase
Keywords: GTP-dependent PEPCK, P-loop, R-loop, omega-loop, Anaplerotic reaction, LYASE, TRANSFERASE
Deposited on 2014-10-21, released 2015-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: pckG, MRA_0219
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5TYT6 (16-621)
      • expression tag (14-15)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d4wpua1, d4wpua2, d4wpua3
  • Heterogens: GDP, GOL, PEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wpuA (A:)
    hhhhhhssglvpagshmtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseee
    fqrlcdqlveagtfirlnpekhknsylalsdpsdvarvasrtyicsakeidagptnnwmd
    pgemrsimkdlyrgcmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgk
    aalekmgddgffvkalhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggna
    llgkkcyslriasamahdegwlaehmlilklispenkayyfaaafpsacgktnlamlqpt
    ipgwraetlgddiawmrfgkdgrlyavnpefgffgvapgtnwksnpnamrtiaagntvft
    nvaltddgdvwweglegdpqhlidwkgndwyfretetnaahpnsryctpmsqcpilapew
    ddpqgvpisgilfggrrkttvplvteardwqhgvfigatlgseqtaaaegkvgnvrrdpm
    amlpflgynvgdyfqhwinlgkhadesklpkvffvnwfrrgddgrflwpgfgensrvlkw
    ivdriehkaggattpigtvpavedldldgldvdaadvaaalavdadewrqelplieewlq
    fvgeklptgvkdefdalkerlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wpuA (A:)
    shmtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtf
    irlnpekhknsylalsdpsdvarvasrtyicsakeidagptnnwmdpgemrsimkdlyrg
    cmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvk
    alhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasa
    mahdegwlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddia
    wmrfgkdgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweg
    legdpqhlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfg
    grrkttvplvteardwqhgvfigatlgseqnvrrdpmamlpflgynvgdyfqhwinlgkh
    adesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvpave
    dldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalkerlg