PDB entry 4wpd

View 4wpd on RCSB PDB site
Description: X-ray Crystal Structure of CYP119 complexed with 4-(4-flourophenyl)-1H-imidazole
Class: oxidoreductase
Keywords: Cytochrome P450, 4-(4-flourophenyl)-1H-imidazole ligand bound, OXIDOREDUCTASE
Deposited on 2014-10-17, released 2015-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 119
    Species: Sulfolobus acidocaldarius [TaxId:330779]
    Gene: cyp119, Saci_2081
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wpda_
  • Chain 'B':
    Compound: cytochrome p450 119
    Species: Sulfolobus acidocaldarius [TaxId:330779]
    Gene: cyp119, Saci_2081
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wpdb_
  • Heterogens: 3SQ, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wpdA (A:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wpdA (A:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wpdB (B:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wpdB (B:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksn