PDB entry 4wp6

View 4wp6 on RCSB PDB site
Description: Structure of the Mex67 LRR domain from Chaetomium thermophilum
Class: transport protein
Keywords: LRR domain nuclear export mRNA binding, transport protein
Deposited on 2014-10-17, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA export protein
    Species: Chaetomium thermophilum [TaxId:759272]
    Gene: CTHT_0059630
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wp6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wp6A (A:)
    gshhhhhhsqdpmqaaqetkqkltsclarrynaeqklldlsalgtdetlsslgsfnnqsl
    aeksfkalmhlvsneykdpeqkneaiqavslarndildvgqvyslavtlprlrrldlsgn
    nlenlskiskwqqefrfleelhltgnpvttlpnyateikkwfpslqildgqqirtpqeaa
    esl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wp6A (A:)
    tkqkltsclarrynaeqklldlsalgtdlaeksfkalmhlvsneykdpeqkneaiqavsl
    arndildvgqvyslavtlprlrrldlsgnnlenlskiskwqqefrfleelhltgnpvttl
    pnyateikkwfpslqildgqqirtpqeaaes