PDB entry 4woc

View 4woc on RCSB PDB site
Description: Proteinase-K Post-Surface Acoustic Waves
Class: hydrolase
Keywords: Surface Acoustic Waves, Crystal Manipulation, Serial Crystallography, Acoustic Tweezers, Nanocrystals, HYDROLASE
Deposited on 2014-10-15, released 2015-02-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteinase K
    Species: Parengyodontium album [TaxId:37998]
    Gene: PROK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06873 (0-278)
      • conflict (206)
    Domains in SCOPe 2.08: d4woca_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4wocA (A:)
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa