PDB entry 4wnn

View 4wnn on RCSB PDB site
Description: SPT16-H2A-H2B FACT HISTONE Complex
Class: DNA binding protein
Keywords: FACT, SPT16, Histone, POB3, H2A, H2B, DNA BINDING PROTEIN
Deposited on 2014-10-13, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h2a.1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: HTA1, H2A1, SPT11, YDR225W, YD9934.10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wnna_
  • Chain 'B':
    Compound: Histone H2B.1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: HTB1, H2B1, SPT12, YDR224C, YD9934.09C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02293 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d4wnnb_
  • Chain 'C':
    Compound: histone h2a.1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: HTA1, H2A1, SPT11, YDR225W, YD9934.10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wnnc_
  • Chain 'D':
    Compound: Histone H2B.1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: HTB1, H2B1, SPT12, YDR224C, YD9934.09C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wnnd_
  • Chain 'E':
    Compound: histone h2a.1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: HTA1, H2A1, SPT11, YDR225W, YD9934.10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wnne_
  • Chain 'F':
    Compound: Histone H2B.1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: HTB1, H2B1, SPT12, YDR224C, YD9934.09C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02293 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d4wnnf_
  • Chain 'G':
    Compound: histone h2a.1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: HTA1, H2A1, SPT11, YDR225W, YD9934.10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wnng_
  • Chain 'H':
    Compound: Histone H2B.1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: HTB1, H2B1, SPT12, YDR224C, YD9934.09C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02293 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d4wnnh_
  • Chain 'T':
    Compound: spt16
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WNN (Start-19)
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wnnA (A:)
    msggkggkagsaakasqsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleyl
    aaeilelagnaardnkktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpk
    ksakatkasqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wnnA (A:)
    qsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnk
    ktriiprhlqlairnddelnkllgnv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wnnB (B:)
    mkkrskarketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynk
    kstisareiqtavrlilpgelakhavsegtravtkyssstqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wnnB (B:)
    mkkrskarketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynk
    kstisareiqtavrlilpgelakhavsegtravtkyss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wnnC (C:)
    msggkggkagsaakasqsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleyl
    aaeilelagnaardnkktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpk
    ksakatkasqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wnnC (C:)
    srsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnkk
    triiprhlqlairnddelnkllg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wnnD (D:)
    mkkrskarketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynk
    kstisareiqtavrlilpgelakhavsegtravtkyssstqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wnnD (D:)
    kkrskarketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkk
    stisareiqtavrlilpgelakhavsegtravtkyss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4wnnE (E:)
    msggkggkagsaakasqsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleyl
    aaeilelagnaardnkktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpk
    ksakatkasqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wnnE (E:)
    srsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnkk
    triiprhlqlairnddelnkllg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4wnnF (F:)
    mkkrskarketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynk
    kstisareiqtavrlilpgelakhavsegtravtkyssstqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wnnF (F:)
    mkkrskarketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynk
    kstisareiqtavrlilpgelakhavsegtravtkyss
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4wnnG (G:)
    msggkggkagsaakasqsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleyl
    aaeilelagnaardnkktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpk
    ksakatkasqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wnnG (G:)
    srsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnkk
    triiprhlqlairnddelnkll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4wnnH (H:)
    mkkrskarketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynk
    kstisareiqtavrlilpgelakhavsegtravtkyssstqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wnnH (H:)
    mkkrskarketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynk
    kstisareiqtavrlilpgelakhavsegtravtkyss
    

  • Chain 'T':
    No sequence available.