PDB entry 4wnm

View 4wnm on RCSB PDB site
Description: SYK catalytic domain in complex with a potent triazolopyridine inhibitor
Class: transferase/transferase inhibitor
Keywords: SYK catalytic domain in complex with a potent triazolopyridine based inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-10-13, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-292)
      • expression tag (293)
    Domains in SCOPe 2.07: d4wnma1, d4wnma2
  • Heterogens: 3RT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wnmA (A:)
    mdtevyespyadpeeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavk
    ilkneandpalkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqq
    nrhvkdkniielvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalrad
    enyykaqthgkwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevt
    amlekgermgcpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wnmA (A:)
    vyevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilknpalkdellaeanv
    mqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmk
    yleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapec
    inyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremyd
    lmnlcwtydvenrpgfaavelrlrnyyydvvnh