PDB entry 4wn9

View 4wn9 on RCSB PDB site
Description: Structure of the Nitrogenase MoFe Protein from Clostridium pasteurianum Pressurized with Xenon
Class: oxidoreductase
Keywords: xenon, MoFe protein, nitrogenase, OXIDOREDUCTASE
Deposited on 2014-10-11, released 2015-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Clostridium pasteurianum [TaxId:1501]
    Gene: nifD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wn9a_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Clostridium pasteurianum [TaxId:1501]
    Gene: nifK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wn9b_
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Clostridium pasteurianum [TaxId:1501]
    Gene: nifD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wn9c_
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Clostridium pasteurianum [TaxId:1501]
    Gene: nifK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4wn9d_
  • Heterogens: HCA, ICS, XE, CLF, PRO, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wn9A (A:)
    enlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvv
    mgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnk
    lkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsq
    saghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltg
    datyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakc
    fddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvds
    lvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagv
    plssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlh
    sydyngpyagfrgvvnfghelvngiytpawkmitppwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wn9A (A:)
    nlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvvm
    gpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnkl
    kdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsqs
    aghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltgd
    atyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakcf
    ddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvdsl
    vagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagvp
    lssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlhs
    ydyngpyagfrgvvnfghelvngiytpawkmitppwk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wn9B (B:)
    mldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhf
    kepamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyis
    qmedagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvg
    padmreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltls
    lgsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqli
    dlmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlae
    agiegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghy
    ynpkvgykgairlveeitnvildkierecteedfevvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wn9C (C:)
    enlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvv
    mgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnk
    lkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsq
    saghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltg
    datyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakc
    fddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvds
    lvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagv
    plssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlh
    sydyngpyagfrgvvnfghelvngiytpawkmitppwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wn9C (C:)
    nlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvvm
    gpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnkl
    kdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsqs
    aghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltgd
    atyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakcf
    ddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvdsl
    vagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagvp
    lssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlhs
    ydyngpyagfrgvvnfghelvngiytpawkmitppwk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wn9D (D:)
    mldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhf
    kepamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyis
    qmedagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvg
    padmreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltls
    lgsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqli
    dlmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlae
    agiegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghy
    ynpkvgykgairlveeitnvildkierecteedfevvr