PDB entry 4wmk

View 4wmk on RCSB PDB site
Description: Crystal structure of mouse Xyloside xylosyltransferase 1 complexed with manganese, product ligand and UDP (Product complex II)
Class: transferase/protein binding
Keywords: glycosyltransferase, transferase-protein binding complex
Deposited on 2014-10-09, released 2015-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xyloside xylosyltransferase 1
    Species: Mus musculus [TaxId:10090]
    Gene: Xxylt1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: coagulation factor ix
    Species: Homo sapiens [TaxId:9606]
    Gene: F9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4wmkd_
  • Heterogens: MN, UDP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wmkD (D:)
    mdivdgdqcesnpclnggsckddinsyecwcpfgfegkncellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wmkD (D:)
    qcesnpclnggsckddinsyecwcpfgfegkncel