PDB entry 4wkx

View 4wkx on RCSB PDB site
Description: Reversible S-Nitrosylation in an Engineered Mutant of Pseudomonas aeruginosa Azurin with Red Copper Site
Class: oxidoreductase
Keywords: protein engineering, Red copper site, S-nitrosylation, OXIDOREDUCTASE
Deposited on 2014-10-03, released 2015-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (45)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d4wkxa_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (45)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d4wkxb_
  • Heterogens: CU, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wkxA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmgenwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    hkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wkxB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmgenwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    hkgtltlk