PDB entry 4wkq

View 4wkq on RCSB PDB site
Description: 1.85 angstrom structure of EGFR kinase domain with gefitinib
Class: transferase/transferase inhibitor
Keywords: inhibitor, complex, kinase, epidermal growth factor receptor, TRANSFERASE, transferase-transferase inhibitor complex
Deposited on 2014-10-03, released 2014-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.196
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4wkqa1, d4wkqa2
  • Heterogens: IRE, NA, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wkqA (A:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wkqA (A:)
    amgeapnqallrilketefkkikvlgsgtvykglwipegekvkipvaikespkankeild
    eayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqi
    akgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwm
    alesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppicti
    dvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdmddvvdadeylipq