PDB entry 4wje

View 4wje on RCSB PDB site
Description: Crystal structure of Trichomonas vaginalis triosephosphate isomerase V45A at 1.3 Angstroms
Class: isomerase
Keywords: isomerase glycolysis monomer mutant, ISOMERASE
Deposited on 2014-09-29, released 2015-10-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_096350
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2FT29
      • engineered mutation (47)
    Domains in SCOPe 2.05: d4wjea_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wjeA (A:)
    gphmrtffvggnwkanpktvqeaeklvemlngakvegnvevvvaapfaflptlqqklrkd
    wkvsaenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfale
    ngmkiiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkva
    stqdaqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggasl
    eagfinivnsnvhsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wjeA (A:)
    rtffvggnwkanpktvqeaeklvemlngakvegnvevvvaapfaflptlqqklrkdwkvs
    aenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfalengmk
    iiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastqd
    aqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggasleagf
    inivnsnvhs