PDB entry 4wiu

View 4wiu on RCSB PDB site
Description: Crystal Structure of PEPCK (Rv0211) from Mycobacterium tuberculosis in complex with oxalate and Mn2+
Class: lyase,transferase
Keywords: GTP-dependent PEPCK, P-loop, R-loop, omega-loop, LYASE
Deposited on 2014-09-26, released 2014-10-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.157
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: pckG, MRA_0219
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5TYT6 (2-607)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4wiua1, d4wiua2
  • Heterogens: MN, OXL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wiuA (A:)
    shmtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtf
    irlnpekhknsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrg
    cmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvk
    alhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasa
    mahdegwlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddia
    wmrfgkdgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweg
    legdpqhlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfg
    grrkttvplvteardwqhgvfigatlgseqtaaaegkvgnvrrdpmamlpflgynvgdyf
    qhwinlgkhadesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggatt
    pigtvpavedldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdef
    dalkerlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wiuA (A:)
    shmtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtf
    irlnpekhknsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrg
    cmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvk
    alhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasa
    mahdegwlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddia
    wmrfgkdgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweg
    legdpqhlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfg
    grrkttvplvteardwqhgvfigatlgseqtnvrrdpmamlpflgynvgdyfqhwinlgk
    hadesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvpav
    edldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalkerlg