PDB entry 4wiq

View 4wiq on RCSB PDB site
Description: The structure of Murine alpha-Dystroglycan T190M mutant N-terminal domain.
Class: structural protein
Keywords: mutant, dystroglycanopathy, structural protein
Deposited on 2014-09-26, released 2015-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dystroglycan
    Species: Mus musculus [TaxId:10090]
    Gene: Dag1, Dag-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62165
      • engineered mutation (140)
    Domains in SCOPe 2.08: d4wiqa1, d4wiqa2
  • Heterogens: EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wiqA (A:)
    svlsdfqeavptvvgipdgtavvgrsfrvsiptdliassgeiikvsaagkealpswlhwd
    phshileglpldtdkgvhyisvsaarlgangshvpqtssvfsievypedhnepqsvhaas
    sdpgevvpsacaadepvtvlmvildadltkmtpkqridllnrmqsfsevelhnmklvpvv
    nnrlfdmsafmagpgnakkvvengallswklgcslnqnsvpdirgvetparegamsaqlg
    ypvvgwhiankkptlpkrlrrqih
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wiqA (A:)
    avptvvgipdgtavvgrsfrvsiptdliassgeiikvsaagkealpswlhwdphshileg
    lpldtdkgvhyisvsaarlgangshvpqtssvfsievypedhnepqacaadepvtvlmvi
    ldadltkmtpkqridllnrmqsfsevelhnmklvpvvnnrlfdmsafmagpgnakkvven
    gallswklgcslnqnsvpdirgvetparegamsaqlgypvvgwhiankkpt