PDB entry 4wie

View 4wie on RCSB PDB site
Description: Crystal structure of apo-PEPCK from Mycobacterium tuberculosis with glycerol
Class: lyase,transferase
Keywords: GTP-dependent PEPCK, P-loop, R-loop, omega- loop, Rate-limiting gluconeogenic enzyme, kinase, phosphoryl transfer, metal binding, LYASE, TRANSFERASE
Deposited on 2014-09-25, released 2014-10-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.141
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [GTP]
    Species: Mycobacterium tuberculosis [TaxId:419947]
    Gene: pckG, MRA_0219
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5TYT6 (16-621)
      • expression tag (14-15)
    Domains in SCOPe 2.06: d4wiea1, d4wiea2, d4wiea3
  • Heterogens: MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wieA (A:)
    hhhhhhssglvpagshmtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseee
    fqrlcdqlveagtfirlnpekhknsylalsdpsdvarvesrtyicsakeidagptnnwmd
    pgemrsimkdlyrgcmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgk
    aalekmgddgffvkalhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggna
    llgkkcyslriasamahdegwlaehmlilklispenkayyfaaafpsacgktnlamlqpt
    ipgwraetlgddiawmrfgkdgrlyavnpefgffgvapgtnwksnpnamrtiaagntvft
    nvaltddgdvwweglegdpqhlidwkgndwyfretetnaahpnsryctpmsqcpilapew
    ddpqgvpisgilfggrrkttvplvteardwqhgvfigatlgseqtaaaegkvgnvrrdpm
    amlpflgynvgdyfqhwinlgkhadesklpkvffvnwfrrgddgrflwpgfgensrvlkw
    ivdriehkaggattpigtvpavedldldgldvdaadvaaalavdadewrqelplieewlq
    fvgeklptgvkdefdalkerlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wieA (A:)
    shmtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtf
    irlnpekhknsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrg
    cmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvk
    alhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasa
    mahdegwlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddia
    wmrfgkdgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweg
    legdpqhlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfg
    grrkttvplvteardwqhgvfigatlgseqtnvrrdpmamlpflgynvgdyfqhwinlgk
    hadesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvpav
    edldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalkerlg