PDB entry 4wi0

View 4wi0 on RCSB PDB site
Description: Crystal structure of Coh3ScaB-XDoc_M2ScaA complex: A C-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
Class: structural protein
Keywords: cellulosome, cohesin, dockerin, type II cohesin-dockerin, Coh-XDoc, protein-protein interaction, structural protein
Deposited on 2014-09-24, released 2015-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosomal scaffoldin adaptor protein B
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: ScaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WYN3 (1-167)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d4wi0a_
  • Chain 'B':
    Compound: cellulosomal scaffoldin
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: cipV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RPL0 (0-155)
      • engineered mutation (149)
    Domains in SCOPe 2.05: d4wi0b1, d4wi0b2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wi0A (A:)
    mesyitmnfdkntaevgqiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytns
    slptsgellvnedygpivqgvhkisegilnlsrsytaldvyrasespeetgtvavvgfka
    lqkkattvvfehsvtmpngiigttlfnwygnritsgysviqpgeinse
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wi0B (B:)
    gttvsgyinpdfvttsttapivkagftveivgttksavtdsngyfeikdvaagtytvkit
    kanyltreianvsvtadkelstsaspilmwagdmaiggtqdgainledileickafntss
    tdakyqvgldlnrdgaisledvmivakhfgkvssdy