PDB entry 4wi0
View 4wi0 on RCSB PDB site
Description: Crystal structure of Coh3ScaB-XDoc_M2ScaA complex: A C-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
Class: structural protein
Keywords: cellulosome, cohesin, dockerin, type II cohesin-dockerin, Coh-XDoc, protein-protein interaction, structural protein
Deposited on
2014-09-24, released
2015-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated
2015-10-07, with a file datestamp of
2015-10-02.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cellulosomal scaffoldin adaptor protein B
Species: Acetivibrio cellulolyticus [TaxId:35830]
Gene: ScaB
Database cross-references and differences (RAF-indexed):
- Uniprot Q7WYN3 (1-167)
- initiating methionine (0)
Domains in SCOPe 2.05: d4wi0a_ - Chain 'B':
Compound: cellulosomal scaffoldin
Species: Acetivibrio cellulolyticus [TaxId:35830]
Gene: cipV
Database cross-references and differences (RAF-indexed):
- Uniprot Q9RPL0 (0-155)
- engineered mutation (149)
Domains in SCOPe 2.05: d4wi0b1, d4wi0b2 - Heterogens: CA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4wi0A (A:)
mesyitmnfdkntaevgqiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytns
slptsgellvnedygpivqgvhkisegilnlsrsytaldvyrasespeetgtvavvgfka
lqkkattvvfehsvtmpngiigttlfnwygnritsgysviqpgeinse
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4wi0B (B:)
gttvsgyinpdfvttsttapivkagftveivgttksavtdsngyfeikdvaagtytvkit
kanyltreianvsvtadkelstsaspilmwagdmaiggtqdgainledileickafntss
tdakyqvgldlnrdgaisledvmivakhfgkvssdy