PDB entry 4whg

View 4whg on RCSB PDB site
Description: Crystal Structure of TR3 LBD in complex with Molecule 3
Class: transcription
Keywords: lbd, transcription
Deposited on 2014-09-22, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 4 group A member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A1, GFRP1, HMR, NAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4whga_
  • Chain 'B':
    Compound: Nuclear receptor subfamily 4 group A member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A1, GFRP1, HMR, NAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4whgb_
  • Heterogens: GOL, 3NB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4whgA (A:)
    mskpkqppdaspanlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydl
    lsgslevirkwaekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglv
    lhrlqcargfgdwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqn
    riasclkehvaavagepqpasclsrllgklpelrtlctqglqrifylkledlvppppiid
    kifmdtlpflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whgA (A:)
    panlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkw
    aekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfg
    dwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehva
    avagasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdtlpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4whgB (B:)
    mskpkqppdaspanlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydl
    lsgslevirkwaekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglv
    lhrlqcargfgdwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqn
    riasclkehvaavagepqpasclsrllgklpelrtlctqglqrifylkledlvppppiid
    kifmdtlpflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whgB (B:)
    panlltslvrahldsgpstakldyskfqelvlpkedagdvqqfydllsgslevirkwaek
    ipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfgdwi
    dsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehvaava
    pqasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdtlpf