PDB entry 4wha

View 4wha on RCSB PDB site
Description: Lipoxygenase-1 (soybean) L546A/L754A mutant
Class: oxidoreductase
Keywords: lipoxygenase, tunneling, C-H activation, OXIDOREDUCTASE
Deposited on 2014-09-21, released 2014-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seed linoleate 13S-lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • variant (159)
      • engineered mutation (545)
      • engineered mutation (753)
    Domains in SCOPe 2.07: d4whaa1, d4whaa2
  • Heterogens: FE, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4whaA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqsainangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieiasthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4whaA (A:)
    hkikgtvvlmpknelenlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptl
    gagesafnihfewdgsmgipgafyiknymqvefflksltleaistirfvcnswvyntkly
    ksvriffanhtyvpsetpaplveyreeelkslrgngtgerkeydriydydvyndlgnpdk
    seklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdalei
    gtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikely
    rtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiyg
    dqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilfl
    redgtlkpvaielslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlm
    shwlnthaamepfviathrhlsvlhpiyklltphyrnnmninalarqsainangiiettf
    lpskysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadglei
    waaiktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlve
    vcliiiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrt
    itsklptlislsvieiasthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklv
    rrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi