PDB entry 4wgv

View 4wgv on RCSB PDB site
Description: Crystal structure of Staphylococcus capitis divalent metal ion transporter (DMT) in complex with nanobody
Class: transport protein
Keywords: membrane protein, transporter, SLC11, transition-metal ions, transport protein, NRAMP, DMT, LeuT fold
Deposited on 2014-09-19, released 2014-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Divalent metal cation transporter MntH
    Species: Staphylococcus capitis VCU116 [TaxId:904334]
    Gene: mntH, SEVCU116_0269
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Camelid antibody fragment, nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WGV (Start-123)
    Domains in SCOPe 2.07: d4wgvb_
  • Chain 'C':
    Compound: Divalent metal cation transporter MntH
    Species: Staphylococcus capitis VCU116 [TaxId:904334]
    Gene: mntH, SEVCU116_0269
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Camelid antibody fragment, nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WGV (Start-123)
    Domains in SCOPe 2.07: d4wgvd_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wgvB (B:)
    gpsqvqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgna
    nyadsvkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqv
    tvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wgvB (B:)
    vqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnanyad
    svkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvtvss
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wgvD (D:)
    gpsqvqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgna
    nyadsvkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqv
    tvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wgvD (D:)
    vqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnanyad
    svkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvtvss