PDB entry 4wfu

View 4wfu on RCSB PDB site
Description: Bovine allergen Bos d 2 in the trigonal space group P3221.
Class: allergen
Keywords: Allergen, Lipocalin
Deposited on 2014-09-17, released 2015-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Allergen Bos d 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wfua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wfuA (A:)
    qetpaeidpskipgewriiyaaadnkdkiveggplrnyyrriecindceslsitfylkdq
    gtcllltevakrqegyvyvlefygtntlevihvsenmlvtyvenydgeritkmteglakg
    tsftpeelekyqqlnsergvpnenienliktdncpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wfuA (A:)
    eidpskipgewriiyaaadnkdkiveggplrnyyrriecindceslsitfylkdqgtcll
    ltevakrqegyvyvlefygtntlevihvsenmlvtyvenydgeritkmteglakgtsftp
    eelekyqqlnsergvpnenienliktdncpp