PDB entry 4wfo

View 4wfo on RCSB PDB site
Description: manganese-substituted soybean lipoxygenase-1
Class: oxidoreductase
Keywords: lipoxygenase, manganese, metal substitution, OXIDOREDUCTASE
Deposited on 2014-09-16, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seed linoleate 13S-lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-857)
      • variant (178)
    Domains in SCOPe 2.07: d4wfoa1, d4wfoa2
  • Heterogens: MN, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wfoA (A:)
    mgsshhhhhhenlyfqsnamfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvs
    lqlisatkadahgkgkvgkdtflegintslptlgagesafnihfewdgsmgipgafyikn
    ymqvefflksltleaisnqgtirfvcnswvyntklyksvriffanhtyvpsetpaplvey
    reeelkslrgngtgerkeydriydydvyndlgnpdkseklarpvlggsstfpyprrgrtg
    rgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqivqpafesafdlkstpi
    efhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawm
    tdeefaremiagvnpcvirgleefppksnldpaiygdqsskitadsldldgytmdealgs
    rrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvaielslphsagdlsa
    avsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamepfviathrhlsvl
    hpiyklltphyrnnmninalarqslinangiiettflpskysvemssavyknwvftdqal
    padlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyvplyyardddvkn
    dselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasalhaavnfgqypyg
    glimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlislsvieilsthasde
    vylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytlly
    psseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wfoA (A:)
    ghkikgtvvlmpknelenlnaflgrsvslqlisatkadahgkgkvgkdtflegintslpt
    lgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfvcnswvyn
    tklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkeydriydydvyndlg
    npdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskd
    aleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvi
    kelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldp
    aiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrt
    ilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwllakayvivndscy
    hqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmninalarqslinangii
    ettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaad
    gleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtle
    dlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeeminnheka
    ylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeie
    eklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi