PDB entry 4wem

View 4wem on RCSB PDB site
Description: Co-complex structure of the F4 fimbrial adhesin FaeG variant ac with llama single domain antibody V1
Class: structural protein
Keywords: Complex, llama single domain antibody, adhesin, nanobody, structural protein
Deposited on 2014-09-10, released 2015-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: K88 fimbrial protein AC
    Species: Escherichia coli [TaxId:562]
    Gene: faeG
    Database cross-references and differences (RAF-indexed):
    • Uniprot L7XD53 (Start-253)
      • expression tag (254-255)
      • expression tag (258-271)
  • Chain 'B':
    Compound: Anti-F4+ETEC bacteria VHH variable region
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wemb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wemB (B:)
    qvqlqesggglvqaggslrlsceasgnvdridamgwfrqapgkqrefvgyiseggilnyg
    dfvkgrftisrdnakntvylqmsnlksedtgvyfcaashwgtllikgiehwgkgtqvtvs
    shhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wemB (B:)
    qvqlqesggglvqaggslrlsceasgnvdridamgwfrqapgkqrefvgyiseggilnyg
    dfvkgrftisrdnakntvylqmsnlksedtgvyfcaashwgtllikgiehwgkgtqvtvs
    s