PDB entry 4weg

View 4weg on RCSB PDB site
Description: influenza virus neuraminidase N9 in complex 2,3-difluorosialic acid
Class: hydrolase
Keywords: influenza virus neuraminidase, N9, complex, 2, 3-difluorosialic acid, second binding site, HYDROLASE
Deposited on 2014-09-10, released 2015-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus (A/tern/Australia/G70C/1975(H11N9)) [TaxId:384509]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4wega_
  • Heterogens: SFJ, NAG, BMA, MAN, CA, DF4, FSI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wegA (A:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl