PDB entry 4wef

View 4wef on RCSB PDB site
Description: Structure of the Hemagglutinin-neuraminidase from Human parainfluenza virus type III: complex with difluorosialic acid
Class: viral protein
Keywords: neuraminidase, hPIV3 HN, complex, difluorosialic acid, covalent inhibitor, second receptor binding site, VIRAL PROTEIN
Deposited on 2014-09-10, released 2015-09-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase glycoprotein
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Gene: HN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WJ03 (0-430)
      • engineered mutation (266)
    Domains in SCOPe 2.05: d4wefa_
  • Chain 'B':
    Compound: hemagglutinin-neuraminidase glycoprotein
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Gene: HN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WJ03 (0-430)
      • engineered mutation (266)
    Domains in SCOPe 2.05: d4wefb_
  • Heterogens: NAG, BMA, FUC, FSI, DF4, SFJ, SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wefA (A:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywggegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
    lfkteipkscs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wefB (B:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywggegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
    lfkteipkscs