PDB entry 4we7

View 4we7 on RCSB PDB site
Description: Structure and receptor binding preferences of recombinant human A(H3N2) virus hemagglutinins
Class: viral protein
Keywords: Hemagglutinin, HA1, H3N2, influenza virus, VIRAL PROTEIN
Deposited on 2014-09-09, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:1392907]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot U3N7S5 (5-272)
      • expression tag (3-4)
      • conflict (181)
      • expression tag (273-274)
    Domains in SCOPe 2.07: d4we7a1, d4we7a2, d4we7a3
  • Chain 'B':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:1392907]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot U3N7S5 (5-272)
      • expression tag (3-4)
      • conflict (181)
      • expression tag (273-274)
    Domains in SCOPe 2.07: d4we7b1, d4we7b2, d4we7b3
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:1392907]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot U3N7S5 (5-272)
      • expression tag (3-4)
      • conflict (181)
      • expression tag (273-274)
    Domains in SCOPe 2.07: d4we7c1, d4we7c2, d4we7c3
  • Chain 'D':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:1392907]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot U3N7S5 (5-272)
      • expression tag (3-4)
      • conflict (181)
      • expression tag (273-274)
    Domains in SCOPe 2.07: d4we7d1, d4we7d2, d4we7d3
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4we7A (A:)
    adlgselvqssstgeicnsphqildgenctlidallgdpqcdgfqnkkwdlfverskahs
    ncypydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsnnsffsrlnwlt
    hlnfkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqaagritvstkrsqqavip
    nvgsrprvrnipsrvsiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapig
    kcnsacitpngsipndkpfqnvnritygacpryskqnsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4we7A (A:)
    gselvqssstgeicnsphqildgenctlidallgdpqcdgfqnkkwdlfverskahsncy
    pydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsnnsffsrlnwlthln
    fkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqaagritvstkrsqqavipnvg
    srprvrnipsrvsiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcn
    sacitpngsipndkpfqnvnritygacprysk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4we7B (B:)
    adlgselvqssstgeicnsphqildgenctlidallgdpqcdgfqnkkwdlfverskahs
    ncypydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsnnsffsrlnwlt
    hlnfkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqaagritvstkrsqqavip
    nvgsrprvrnipsrvsiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapig
    kcnsacitpngsipndkpfqnvnritygacpryskqnsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4we7B (B:)
    gselvqssstgeicnsphqildgenctlidallgdpqcdgfqnkkwdlfverskahsncy
    pydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsnnsffsrlnwlthln
    fkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqaagritvstkrsqqavipnvg
    srprvrnipsrvsiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcn
    sacitpngsipndkpfqnvnritygacprysk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4we7C (C:)
    adlgselvqssstgeicnsphqildgenctlidallgdpqcdgfqnkkwdlfverskahs
    ncypydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsnnsffsrlnwlt
    hlnfkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqaagritvstkrsqqavip
    nvgsrprvrnipsrvsiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapig
    kcnsacitpngsipndkpfqnvnritygacpryskqnsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4we7C (C:)
    gselvqssstgeicnsphqildgenctlidallgdpqcdgfqnkkwdlfverskahsncy
    pydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsnnsffsrlnwlthln
    fkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqaagritvstkrsqqavipnvg
    srprvrnipsrvsiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcn
    sacitpngsipndkpfqnvnritygacprysk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4we7D (D:)
    adlgselvqssstgeicnsphqildgenctlidallgdpqcdgfqnkkwdlfverskahs
    ncypydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsnnsffsrlnwlt
    hlnfkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqaagritvstkrsqqavip
    nvgsrprvrnipsrvsiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapig
    kcnsacitpngsipndkpfqnvnritygacpryskqnsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4we7D (D:)
    gselvqssstgeicnsphqildgenctlidallgdpqcdgfqnkkwdlfverskahsncy
    pydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsnnsffsrlnwlthln
    fkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqaagritvstkrsqqavipnvg
    srprvrnipsrvsiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcn
    sacitpngsipndkpfqnvnritygacprysk