PDB entry 4we6

View 4we6 on RCSB PDB site
Description: The crystal structure of hemagglutinin HA1 domain from influenza virus A/Perth/142/2007(H3N2)
Class: viral protein
Keywords: hemagglutinin, HA1, H3N2, influenza virus, VIRAL PROTEIN
Deposited on 2014-09-09, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:529795]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8HJ45 (5-End)
      • expression tag (2-4)
      • conflict (178)
    Domains in SCOPe 2.07: d4we6a1, d4we6a2
  • Chain 'B':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:529795]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8HJ45 (5-End)
      • expression tag (2-4)
      • conflict (178)
    Domains in SCOPe 2.07: d4we6b1, d4we6b2
  • Heterogens: NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4we6A (A:)
    adlgselvqssstgeicdsphqildgknctlidallgdpqcdgfqnkkwdlfverskays
    ncypydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsknsffsrlnwlt
    hlnfkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqasgritvstkrsqqtvsp
    nigsrprvrnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapig
    kcnsecitpngsipndkpfqnvnritygacpryvkqntl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4we6A (A:)
    lgselvqssstgeicdsphqildgknctlidallgdpqcdgfqnkkwdlfverskaysnc
    ypydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsknsffsrlnwlthl
    nfkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqasgritvstkrsqqtvspni
    gsrprvrnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkc
    nsecitpngsipndkpfqnvnritygacpryvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4we6B (B:)
    adlgselvqssstgeicdsphqildgknctlidallgdpqcdgfqnkkwdlfverskays
    ncypydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsknsffsrlnwlt
    hlnfkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqasgritvstkrsqqtvsp
    nigsrprvrnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapig
    kcnsecitpngsipndkpfqnvnritygacpryvkqntl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4we6B (B:)
    lgselvqssstgeicdsphqildgknctlidallgdpqcdgfqnkkwdlfverskaysnc
    ypydvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsknsffsrlnwlthl
    nfkypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqasgritvstkrsqqtvspni
    gsrprvrnipsrisiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkc
    nsecitpngsipndkpfqnvnritygacpryvk