PDB entry 4wdy

View 4wdy on RCSB PDB site
Description: JC Polyomavirus VP1 five-fold pore mutant N221Q
Class: viral protein
Keywords: beta-sandwich, jelly-roll, viral major capsid protein, five-fold pore, viral protein
Deposited on 2014-09-09, released 2015-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein VP1
    Species: JC polyomavirus [TaxId:10632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03089
      • engineered mutation (203)
    Domains in SCOPe 2.07: d4wdya_
  • Chain 'B':
    Compound: Major capsid protein VP1
    Species: JC polyomavirus [TaxId:10632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03089
      • engineered mutation (203)
    Domains in SCOPe 2.07: d4wdyb_
  • Chain 'C':
    Compound: Major capsid protein VP1
    Species: JC polyomavirus [TaxId:10632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03089 (Start-271)
      • engineered mutation (203)
    Domains in SCOPe 2.07: d4wdyc_
  • Chain 'D':
    Compound: Major capsid protein VP1
    Species: JC polyomavirus [TaxId:10632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03089 (Start-271)
      • engineered mutation (203)
    Domains in SCOPe 2.07: d4wdyd_
  • Chain 'E':
    Compound: Major capsid protein VP1
    Species: JC polyomavirus [TaxId:10632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03089
      • engineered mutation (203)
    Domains in SCOPe 2.07: d4wdye_
  • Heterogens: GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wdyA (A:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdml
    pcysvariplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvq
    gtsfhffsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggeqvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wdyA (A:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva
    riplpnlnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggea
    lelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent
    ryfgtltggeqvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq
    wrglsryfkvqlrkrrvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wdyB (B:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdml
    pcysvariplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvq
    gtsfhffsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggeqvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wdyB (B:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva
    riplpnlnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggea
    lelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent
    ryfgtltggeqvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq
    wrglsryfkvqlrkrrvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wdyC (C:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdml
    pcysvariplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvq
    gtsfhffsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggeqvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wdyC (C:)
    evlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysvar
    iplpnlnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggeal
    elqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentr
    yfgtltggeqvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqw
    rglsryfkvqlrkrrvkn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wdyD (D:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdml
    pcysvariplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvq
    gtsfhffsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggeqvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wdyD (D:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva
    riplpnlnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggea
    lelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent
    ryfgtltggeqvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq
    wrglsryfkvqlrkrrvkn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4wdyE (E:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdml
    pcysvariplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvq
    gtsfhffsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggeqvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wdyE (E:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva
    riplpnlnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggea
    lelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent
    ryfgtltggeqvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq
    wrglsryfkvqlrkrrvk