PDB entry 4wd6

View 4wd6 on RCSB PDB site
Description: Crystal Structure of DIM-1 metallo-beta-lactamase
Class: hydrolase
Keywords: zinc metalloenzyme, hydrolase
Deposited on 2014-09-07, released 2014-09-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: blaDIM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4wd6a_
  • Chain 'B':
    Compound: metallo-beta-lactamase
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: blaDIM-1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wd6A (A:)
    ndevpelriekvkeniflhtsysrvngfglvssnglvvidkgnafivdtpwsdrdtetlv
    hwirkngyellgsvsthwhedrtagikwlndqsistyattstnhllkenkkepakytlkg
    nestlvdglievfypggghtidnvvvwlpkskilfggcfvrsldseglgytgeahidqws
    rsaqnalsryseaqivipghgkigdiallkhtkslaetasnksiqpnanasad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wd6A (A:)
    devpelriekvkeniflhtsysrvngfglvssnglvvidkgnafivdtpwsdrdtetlvh
    wirkngyellgsvsthwhedrtagikwlndqsistyattstnhllkenkkepakytlkgn
    estlvdglievfypggghtidnvvvwlpkskilfggcfvrsldseglgytgeahidqwsr
    saqnalsryseaqivipghgkigdiallkhtkslaetas
    

  • Chain 'B':
    No sequence available.