PDB entry 4wd4

View 4wd4 on RCSB PDB site
Description: Crystal structure of human HO1 H25R
Class: oxidoreductase
Keywords: Heme oxygenase, Proximal histidine, Heme coordination, Site-directed mutagenesis, Biliverdin biosensor, OXIDOREDUCTASE
Deposited on 2014-09-06, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO, HO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09601
      • engineered mutation (28)
    Domains in SCOPe 2.07: d4wd4a_
  • Chain 'B':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO, HO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09601
      • engineered mutation (28)
    Domains in SCOPe 2.07: d4wd4b_
  • Chain 'C':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO, HO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09601
      • engineered mutation (28)
    Domains in SCOPe 2.07: d4wd4c_
  • Chain 'D':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO, HO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09601
      • engineered mutation (28)
    Domains in SCOPe 2.07: d4wd4d_
  • Heterogens: HEM, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wd4A (A:)
    gshmmerpqpdsmpqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyh
    iyvaleeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvk
    rlhevgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasat
    kfkqlyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsrapgl
    rqrasnkvqdsapvetprgkpplntrsqapllrwvltlsflvatvavglyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wd4A (A:)
    pqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wd4B (B:)
    gshmmerpqpdsmpqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyh
    iyvaleeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvk
    rlhevgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasat
    kfkqlyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsrapgl
    rqrasnkvqdsapvetprgkpplntrsqapllrwvltlsflvatvavglyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wd4B (B:)
    pqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wd4C (C:)
    gshmmerpqpdsmpqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyh
    iyvaleeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvk
    rlhevgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasat
    kfkqlyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsrapgl
    rqrasnkvqdsapvetprgkpplntrsqapllrwvltlsflvatvavglyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wd4C (C:)
    pqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wd4D (D:)
    gshmmerpqpdsmpqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyh
    iyvaleeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvk
    rlhevgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasat
    kfkqlyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsrapgl
    rqrasnkvqdsapvetprgkpplntrsqapllrwvltlsflvatvavglyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wd4D (D:)
    pqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth