PDB entry 4wd2

View 4wd2 on RCSB PDB site
Description: Crystal structure of an aromatic amino acid aminotransferase from Burkholderia cenocepacia J2315
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2014-09-06, released 2014-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aromatic-amino-acid transaminase TyrB
    Species: Burkholderia cenocepacia K56-2Valvano [TaxId:985076]
    Gene: tyrB, BURCENK562V_C3553
    Database cross-references and differences (RAF-indexed):
    • Uniprot T0EWC0 (8-407)
      • expression tag (7)
    Domains in SCOPe 2.07: d4wd2a1, d4wd2a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wd2A (A:)
    mahhhhhhmfehidaypgdpiltlnenfqkdprdqkvnlsigiyfdaegripvmgavrea
    etalqrdsgpkpylpmvglaayrdavqslvfgadhparaagriatlqtlggsgalkvgad
    flkryfpdsqvwlsdpswenhrfiferagftvntypyydeatgglkfdamlaaidalpar
    sivllhacchnptgvdldegqweklidviearellpfvdmayqgfgagldadafavrela
    rrgvptlvansfsknfslygervgglsvvcedaaaaervlgqlagavrsnysnpqtygak
    vvaavlgtpalrkqweeelsamcrriarmrqsihdglrdhvsgealtryvkqrgmftytg
    ltesqvdalrevhgvyilrsgrmcvaglndsnvgivadaigkvlksga
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wd2A (A:)
    hmfehidaypgdpiltlnenfqkdprdqkvnlsigiyfdaegripvmgavreaetalqrd
    sgpkpylpmvglaayrdavqslvfgadhparaagriatlqtlggsgalkvgadflkryfp
    dsqvwlsdpswenhrfiferagftvntypyydeatgglkfdamlaaidalparsivllha
    cchnptgvdldegqweklidviearellpfvdmayqgfgagldadafavrelarrgvptl
    vansfsknfslygervgglsvvcedaaaaervlgqlagavrsnysnpqtygakvvaavlg
    tpalrkqweeelsamcrriarmrqsihdglrdhvaltryvkqrgmftytgltesqvdalr
    evhgvyilrsgrmcvaglndsnvgivadaigkvlksga