PDB entry 4wcz

View 4wcz on RCSB PDB site
Description: Crystal structure of a putative enoyl-CoA hydratase/isomerase from Novosphingobium aromaticivorans
Class: isomerase
Keywords: enoyl-CoA hydratase/isomerase, structural genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC
Deposited on 2014-09-05, released 2014-12-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.169
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_3457
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4wcza_
  • Chain 'B':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_3457
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4wczb_
  • Chain 'C':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_3457
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4XEF6 (23-271)
      • expression tag (22)
    Domains in SCOPe 2.04: d4wczc_
  • Chain 'D':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_3457
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_3457
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_3457
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4XEF6 (23-271)
      • expression tag (22)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wczA (A:)
    mhhhhhhssgvdlgtqdnlyfqsmslrlerdgavarllidradrrnafsldmwqrlpell
    aeasgddalrvlvvksanggafcagadiaellankddaafhaanqqainraqyelarfrl
    ptvamvegdcigggcgialacdmriaapaarfgitpaklglvyplhdvkllvdlvgpgqa
    rrlmftgglidaneahriglvellgesedalvgqlatvssfstqaiksfvrrvldgqvad
    dadslrvfasafegadfregtgaflekrppvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wczA (A:)
    mslrlerdgavarllidradrrnafsldmwqrlpellaeasgddalrvlvvksanggafc
    agadiaellankddaafhaanqqainraqyelarfrlptvamvegdcigggcgialacdm
    riaapaarfgitpaklglvyplhdvkllvdlvgpgqarrlmftgglidaneahriglvel
    lgesedalvgqlatvssfstqaiksfvrrvldgqvaddadslrvfasafegadfregtga
    flekrppvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wczB (B:)
    mhhhhhhssgvdlgtqdnlyfqsmslrlerdgavarllidradrrnafsldmwqrlpell
    aeasgddalrvlvvksanggafcagadiaellankddaafhaanqqainraqyelarfrl
    ptvamvegdcigggcgialacdmriaapaarfgitpaklglvyplhdvkllvdlvgpgqa
    rrlmftgglidaneahriglvellgesedalvgqlatvssfstqaiksfvrrvldgqvad
    dadslrvfasafegadfregtgaflekrppvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wczB (B:)
    mslrlerdgavarllidradrrnafsldmwqrlpellaeasgddalrvlvvksanggafc
    agadiaellankddaafhaanqqainraqyelarfrlptvamvegdcigggcgialacdm
    riaapaarfgitpaklglvyplhdvkllvdlvgpgqarrlmftgglidaneahriglvel
    lgesedalvgqlatvssfstqaiksfvrrvldgqvaddadslrvfasafegadfregtga
    flekrppvf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wczC (C:)
    mhhhhhhssgvdlgtqdnlyfqsmslrlerdgavarllidradrrnafsldmwqrlpell
    aeasgddalrvlvvksanggafcagadiaellankddaafhaanqqainraqyelarfrl
    ptvamvegdcigggcgialacdmriaapaarfgitpaklglvyplhdvkllvdlvgpgqa
    rrlmftgglidaneahriglvellgesedalvgqlatvssfstqaiksfvrrvldgqvad
    dadslrvfasafegadfregtgaflekrppvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wczC (C:)
    smslrlerdgavarllidradrrnafsldmwqrlpellaeasgddalrvlvvksanggaf
    cagadiaellankddaafhaanqqainraqyelarfrlptvamvegdcigggcgialacd
    mriaapaarfgitpaklglvyplhdvkllvdlvgpgqarrlmftgglidaneahriglve
    llgesedalvgqlatvssfstqaiksfvrrvldgqvaddadslrvfasafegadfregtg
    aflekrppvf
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.