PDB entry 4wcy

View 4wcy on RCSB PDB site
Description: Fab fragment of mouse AZ130 monoclonal antibody
Class: immune system
Keywords: Monoclonal antibody, Epstein-Barr virus (EBV), ZEBRA protein, immune system
Deposited on 2014-09-05, released 2015-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: AZ130 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4WCY
  • Chain 'L':
    Compound: AZ130 Light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4WCY (0-End)
    Domains in SCOPe 2.07: d4wcyl1, d4wcyl2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4wcyL (L:)
    nivltqsppslavslgqratiscrasesvdsygnsflhwyqqksgqppklliylasnles
    gvparfsgsgsrtdftltidpleaddaatyycqqnneapftfgsgtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wcyL (L:)
    nivltqsppslavslgqratiscrasesvdsygnsflhwyqqksgqppklliylasnles
    gvparfsgsgsrtdftltidpleaddaatyycqqnneapftfgsgtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne