PDB entry 4wch

View 4wch on RCSB PDB site
Description: Structure of Isolated D Chain of Gigant Hemoglobin from Glossoscolex paulistus
Class: oxygen storage
Keywords: Globin, D chain., OXYGEN STORAGE
Deposited on 2014-09-04, released 2015-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: Isolated Chain D of Gigant Hemoglobin from Glossoscolex Paulistus
  Species: Glossoscolex paulistus [TaxId:1046353]
  Database cross-references and differences (RAF-indexed):
  • PDB 4WCH (0-139)
  Domains in SCOPe 2.08: d4wchd_
• Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4wchD (D:)
  dcsilellkvknqwreafgeghhrvqfglelwkrffdthpevkglfkgvngdniyspefa
  ahaervlsgldmtigllddtnafkaqvthlhsqhversinpefyehflgallhvlpkylg
  tkldqdawtkcfhtiadgik